Research Review
CJC-1295, Ipamorelin, and PT-141: Mechanisms and Combination Research Guide
Why GHRH analogues and ghrelin-receptor agonists are studied together, how PT-141 differs, and what a well-controlled combination study needs.
Blends · Lyophilized Powder
CJC-1295 No DAC / Ipamorelin Research Blend - 10mg Vial
CAS: N/A (Mod GRF 1-29) / 170851-70-4 | Sequence: 29-aa GHRH analogue + 5-aa GHS | Purity: ≥99%
$64.99 / vial
In Stock - Ships Within 24 Hours
- Cold Storage −20 °C lyophilized
- Reconstituted 2–8 °C · 28 days
- HPLC ≥99% third-party verified
SKU PT-CJCIPA-10 · HPLC + MS tested every batch · Insulated cold-pack shipping
What Is CJC-1295 / Ipamorelin?
This research blend combines two growth hormone secretagogues with complementary mechanisms, co-lyophilized at 5 mg each: CJC-1295 without DAC (Modified GRF 1-29), a 29-residue GHRH analogue (3367.97 g/mol), and Ipamorelin (CAS 170851-70-4), a selective pentapeptide ghrelin-receptor agonist (711.85 g/mol).
Mod GRF 1-29 activates the pituitary GHRH receptor, while ipamorelin acts on the growth hormone secretagogue receptor GHS-R1a. Because the two receptors signal through different intracellular pathways, the combination is used as a model of synergistic, pulsatile growth hormone release and of hypothalamic–pituitary–somatotropic axis regulation.
Note that no CAS number is widely registered for the no-DAC form of CJC-1295; the identifier often quoted, 863288-34-0, refers to CJC-1295 with DAC.
Third-Party Certificate of Analysis
Each production lot is independently tested for identity, purity and content. Select a batch to view its analytical results — your vial label lists the batch number.
HPLC purity (UV 220 nm)
99.22%
Tested by: —
| Test | Method | Result | Status |
|---|
CJC-1295 / Ipamorelin Scientific Documentation
Technical reference data and a summary of published preclinical literature, provided for educational purposes.
| CJC-1295 No DAC (Modified GRF 1-29) — 5 mg | |
|---|---|
| Synonyms | Mod GRF (1-29), tetrasubstituted GRF (1-29) |
| CAS Number | Not assignedNo CAS number is widely registered for the no-DAC form. 863288-34-0 is frequently mis-cited; it refers to CJC-1295 with DAC. |
| Molecular Formula | C152H252N44O42 |
| Molecular Weight | 3367.97 g/mol |
| Sequence (3-letter) | Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 |
| Sequence (1-letter) | Y(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 |
| Structure Class | GHRH(1-29) analogue with D-Ala2, Gln8, Ala15 and Leu27 substitutions; no Drug Affinity Complex (DAC) |
| Ipamorelin — 5 mg | |
| Synonyms | NNC 26-0161 |
| CAS Number | 170851-70-4 |
| Molecular Formula | C38H49N9O5 |
| Molecular Weight | 711.85 g/mol |
| Sequence (3-letter) | Aib-His-D-2Nal-D-Phe-Lys-NH2 |
| Sequence (1-letter) | Aib-H-(D-2Nal)-(D-F)-K-NH2 |
| Structure Class | Synthetic pentapeptide growth hormone secretagogue (GHS-R1a agonist) |
| Blend | |
| Form | White lyophilized powder (co-lyophilized blend) |
| Purity | ≥99% (RP-HPLC) per component; identity confirmed by ESI-MS |
| Content per Vial | 5 mg Mod GRF 1-29 + 5 mg Ipamorelin |
| Solubility | Soluble in water, bacteriostatic water and 0.9% saline |
| Storage Conditions | Lyophilized: −20 °C, desiccated and protected from light. Reconstituted: 2–8 °C, use within 28 days. Mod GRF 1-29 is comparatively unstable in solution; prepare working aliquots and keep reconstituted material at 2–8 °C. |
The findings below come from in-vitro and animal studies. Neither CJC-1295 nor ipamorelin is approved by the FDA or any regulatory agency for human use, and nothing on this page is medical advice or a therapeutic claim.
Modified GRF (1-29)
Mod GRF 1-29 is a truncated GHRH analogue whose four amino-acid substitutions improve resistance to DPP-4 cleavage and chemical degradation relative to sermorelin. Without the DAC albumin-binding group its half-life is short (on the order of 30 minutes), in contrast to the multi-day half-life reported for CJC-1295 with DAC.
Ipamorelin: Selective Ghrelin-Receptor Agonist
Ipamorelin is a GHS-R1a agonist. In swine studies it stimulated growth hormone release without significant increases in ACTH or cortisol, a selectivity that distinguished it from GHRP-6 and GHRP-2.
Complementary Signalling Pathways
GHRH-receptor agonists act mainly through cAMP, while GHS-R1a agonists act through phospholipase C and intracellular calcium. Pairing the two mechanisms is a well-documented model for studying synergistic pulsatile GH release.
Pituitary Axis Research
GH secretion is governed by the balance between hypothalamic GHRH (stimulatory), somatostatin (inhibitory) and ghrelin signalling, with IGF-1 providing negative feedback. Short-acting secretagogues such as Mod GRF 1-29 and ipamorelin are used to study this pulsatile pattern, in contrast with long-acting analogues that produce sustained GH elevation.
Research Limitations
Published data mostly characterize each peptide individually; controlled studies of this specific fixed-ratio blend are limited.
Representative literature: Raun K et al., Eur J Endocrinol 1998; Teichman SL et al., J Clin Endocrinol Metab 2006 (CJC-1295 with DAC).
Bacteriostatic Water Ratio Chart (10 mg Vial)
| Diluent Added | Concentration | Per 0.1 mL Aliquot |
|---|---|---|
| 1.0 mL | 10.0 mg/mL | 1 mg |
| 2.0 mL | 5.0 mg/mL | 500 µg |
| 2.5 mL | 4.0 mg/mL | 400 µg |
| 3.0 mL | 3.33 mg/mL | 333 µg |
| 5.0 mL | 2.0 mg/mL | 200 µg |
Concentrations shown are total peptide. Each component (Mod GRF 1-29, Ipamorelin) makes up 50% of the vial content.
Reconstitution Procedure
Allow the vial to reach room temperature. Introduce sterile or bacteriostatic water slowly down the inner glass wall — do not inject directly onto the powder cake. Swirl gently until fully dissolved; do not shake or vortex, as this can promote aggregation.
Temperature Stability
| State | Condition | Typical Stability |
|---|---|---|
| Lyophilized | −20 °C, desiccated | 24+ months |
| Lyophilized | 2–8 °C | Up to 12 months |
| Lyophilized | Room temp (≤25 °C) | Several weeks (transit) |
| Reconstituted | 2–8 °C | Up to 28 days |
| Reconstituted | −20 °C aliquots | Avoid repeated freeze–thaw |
Further Reading
Frequently Purchased Together
Complementary research compounds and lab supplies.